PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004513200.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family bHLH
Protein Properties Length: 242aa    MW: 27602.5 Da    PI: 8.432
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004513200.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH41.62.3e-1362113255
                     HHHHHHHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHHH CS
             HLH   2 rrahnerErrRRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksLq 55 
                     +  hn+ Er RR++iN+ ++ Lr+llP a  ++ kKls  ++  ++ +YI +Lq
  XP_004513200.1  62 KLIHNASERDRRKKINTLYSSLRSLLPVA--EQMKKLSNPATISRVLKYIPELQ 113
                     566*************************7..69999***************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088813.65660112IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
CDDcd000831.61E-1161117No hitNo description
SuperFamilySSF474599.16E-1561130IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.105.6E-1162123IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000109.7E-1163113IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SMARTSM003534.3E-966118IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010106Biological Processcellular response to iron ion starvation
GO:0055072Biological Processiron ion homeostasis
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 242 aa     Download sequence    Send to blast
MLALSPPLFS TIGWPFEEPI SHNQQDYFYK ATDQLFNFHH LVEEENSTPS QATSSDLSMV  60
KKLIHNASER DRRKKINTLY SSLRSLLPVA EQMKKLSNPA TISRVLKYIP ELQKQVEGLL  120
TRKEAILLKL SPQVDEVKSK ESERKKHSKN SGFVVSTSRL NDSEAAIQIS SYSIHKIPLS  180
EILMCLENDG LLLLNISSSQ TFGGKVFYNF HFQVDKEQRL ESEIFSEKLL AIIETKGNFQ  240
VN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004513200.11e-178PREDICTED: transcription factor ORG2-like
TrEMBLA0A072VIS71e-130A0A072VIS7_MEDTR; Transcription factor ORG2-like protein
STRINGGLYMA03G28630.13e-82(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF24023379
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56970.12e-54bHLH family protein